HORDB

ID: hor002331
Uniprot ID: P01362
Protein name: Gamma-bag cell peptide
Gene name: NA
Organism: Aplysia californica (California sea hare)
Family: Molluscan ELH family
Source: Animal
Expression: Bag cell neurons.
Disease: NA
Comments: NA
Taxonomy: Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: RLRFD
Length: 5(103-107)
Propeptide: MKRPNNRPTNTMSLILCLTLSSLCVSSQSASVHGKNFATNRAVKSSSPFVVLSPDDNVVSMSGENGYRSALREAFDKSSRDYDDNGEDVFSNEKRRLRFHKRRLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDLRAPRLRFYSLRKRAAGGMEQSEGQNPETESHSRRKRSVLTPSLSSLGESLESGISKRISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEKGKRSSGVSLLTSNK
Signal peptide: MKRPNNRPTNTMSLILCLTLSSLCVSSQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis a
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002331_AF2.pdb

hor002331_ESM.pdb

Mass:	77734	Formula:	C31H51N11O8
Absent amino acids:	ACEGHIKMNPQSTVWY	Common amino acids:	R
pI:	10.4	Basic residues:	2
Polar residues:	0	Hydrophobic residues:	2
Hydrophobicity:	-118	Boman Index:	-3066
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	78
Instability Index:	7120	Extinction Coefficient cystines:	0
Absorbance 280nm:	0